PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr010041.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 578aa    MW: 64162.9 Da    PI: 4.7292
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr010041.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS452.33e-1382085772374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  ++lL+ecA a+s+g  e+a++++++l++++s +gdp+qR+aay++e+Laar+a+s++ lyk+l+++e +   ss +laa+++++ev+P++kf++++aN
  Pbr010041.1 208 KQLLFECAGALSEGYVEEASTMINELRQMVSIQGDPTQRIAAYMVEGLAARVASSGKFLYKSLKCKEPP---SSYRLAAMQILFEVCPCFKFGFMAAN 302
                  589*****************************************************************9...9************************* PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                   aI ea + e+rvHiiDfdi+qG Q+++L+q+L+s p++pp+l++Tgv++pe++  +   l+ +g+rL+k+Ae+l+vpfef++ va+r++ +++++L 
  Pbr010041.1 303 GAIIEACKDEKRVHIIDFDINQGNQYITLIQTLSSLPGKPPHLKLTGVDDPETVqrHVGGLKIIGQRLEKLAEALKVPFEFHA-VASRTSIVNTSMLG 399
                  ****************************************************99888999***********************.7************* PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  ++pgEal+Vn+++qlh+++desvs+ ++rd++L++vksl+Pk+v++veq++++n+++Fl rf+ea +yysa+fdsl+a lpres++r++vEr++l+r+
  Pbr010041.1 400 CRPGEALVVNFAFQLHHMPDESVSTVNQRDQLLRMVKSLRPKLVTIVEQDMNTNTTPFLPRFVEAYNYYSAVFDSLDAALPRESQDRMNVERQCLARD 497
                  ************************************************************************************************** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ivn+vaceg+er+er e ++kWr+r+++aGF++ p+s+++ ++++ l r+++++ y+v+ee g+l++gW++++L+++SaWr
  Pbr010041.1 498 IVNIVACEGEERIERYEVAGKWRARMTMAGFTSCPMSTSVSDSIRDLSRQYSER-YKVKEEAGALLFGWEEKNLIVASAWR 577
                  ****************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.202181558IPR005202Transcription factor GRAS
PfamPF035141.0E-135208577IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MSLVRPAELS TSYRNPNFYS LKGSNESSSL SAQIFGSDKP KVVYSDDPYS TESYEKYFLD  60
SPMEEVTHPS SSGVSGSSTN PQGASSYQLT AGSVSSLNTQ NPFSTSLMSN FESDYFESQS  120
PDADSFDEDK MRLKLQELER ALLNDNADED DGERNCSSQS MEVDGEWIDP IQNELLHDSP  180
KESSSSDSNA SSTSSNKGIS QVSPRTPKQL LFECAGALSE GYVEEASTMI NELRQMVSIQ  240
GDPTQRIAAY MVEGLAARVA SSGKFLYKSL KCKEPPSSYR LAAMQILFEV CPCFKFGFMA  300
ANGAIIEACK DEKRVHIIDF DINQGNQYIT LIQTLSSLPG KPPHLKLTGV DDPETVQRHV  360
GGLKIIGQRL EKLAEALKVP FEFHAVASRT SIVNTSMLGC RPGEALVVNF AFQLHHMPDE  420
SVSTVNQRDQ LLRMVKSLRP KLVTIVEQDM NTNTTPFLPR FVEAYNYYSA VFDSLDAALP  480
RESQDRMNVE RQCLARDIVN IVACEGEERI ERYEVAGKWR ARMTMAGFTS CPMSTSVSDS  540
IRDLSRQYSE RYKVKEEAGA LLFGWEEKNL IVASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-5422657722375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009368394.10.0PREDICTED: scarecrow-like protein 1 isoform X1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLD9ZJB00.0D9ZJB0_MALDO; SCL domain class transcription factor
STRINGPOPTR_0002s07430.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49883457
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1